PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001224m
Common NameCARUB_v10001224mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 367aa    MW: 41265.9 Da    PI: 7.9878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001224mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Carubv10001224m 14 KGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding49.87.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia +++ gRt++++k++w++
  Carubv10001224m  67 RGAFSQDEESLIIELHAALGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.515961IPR017930Myb domain
SuperFamilySSF466894.49E-2912108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002494.7E-161461IPR001005SANT/Myb domain
CDDcd001677.67E-111761No hitNo description
PROSITE profilePS5129425.90662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-2665116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467111IPR001005SANT/Myb domain
CDDcd001677.44E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRHSCCFKQ KLRKGLWSPE EDEKLLNYIT RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEESLIIE LHAALGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRRKG  120
IDPTTHKPLV TTNELHQTLN VIDQKLTSSE VVKSTGSINN NTHDHQSMVV SNQSGPWWFP  180
AATTTTTTTN QNAAFCFSSS NTTPTVSDQI VSLISSMSTS SSPTPMTSNF NPAAPNNWEL  240
QQLNYCNTVP SQTNSIYSAF FGNNHYTEAS QIMNTNNNNN NNPVLDHHQD MKSWASEILH  300
YTEQNQTSET CLETEVKPDI AKYYWRSASS SSSPNQEAAT LLHDADVEVY GKNLQKLNSM  360
VFDQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0997770.0AY099777.1 Arabidopsis thaliana transcription factor ATMYB4 (At5g26655) mRNA, complete cds.
GenBankAY5196290.0AY519629.1 Arabidopsis thaliana MYB transcription factor (At5g26660) mRNA, complete cds.
GenBankBT0087400.0BT008740.1 Arabidopsis thaliana At5g26655 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287991.10.0hypothetical protein CARUB_v10001224mg
SwissprotQ8LPH60.0MYB86_ARATH; Transcription factor MYB86
TrEMBLR0GVG00.0R0GVG0_9BRAS; Uncharacterized protein
STRINGAT5G26660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.10.0myb domain protein 86